PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn235261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 325aa    MW: 36333.8 Da    PI: 8.3943
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn235261genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.23.9e-33111166359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                   vrYkeClkNhAas+Ggh+vDGCgEfmp  ge+gt++ l+CaAC+CHRnFHRreve 
   Achn235261 111 VVRYKECLKNHAASIGGHVVDGCGEFMPG-GEDGTPEVLRCAACDCHRNFHRREVEG 166
                  689*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-23110167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.3E-31112164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.4E-31113164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.997114163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.62E-19257321IPR009057Homeodomain-like
TIGRFAMsTIGR015651.4E-26260317IPR006455Homeodomain, ZF-HD class
Gene3DG3DSA:1.10.10.601.3E-28260322IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEIRGQEKDL GMSIGYSTSN LSHQPNQDSS SKMFAASMAA DRRRNETLDH HYRNQQMDLK  60
QMQQQQTHIA ARNQSPDLDP DPATIASIAI GTTSNSKTPQ PEPPESTLAG VVRYKECLKN  120
HAASIGGHVV DGCGEFMPGG EDGTPEVLRC AACDCHRNFH RREVEGEPHP VPSSYYHYNH  180
SRNNSHRATT QLVPAPLPPP PPPHHPNPHR YSSHGPIPPV MMSFGGASGG PAESSSEDLN  240
MFHVSIGAQV MGQPPFFPLR KRFRTKFTPG QKDKMQEFAE RLEWKMQKQD EQQVEQFCAE  300
VGVKRQVFKV WMHNNKQAMK KKQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-222613181875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490986.11e-103PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A068U3221e-100A0A068U322_COFCA; Uncharacterized protein
STRINGPOPTR_0005s12420.12e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-61homeobox protein 24